Primary Mouse Cell Lines

Cell Line Origin Mouse Cell Line Description Please note : Available stocks of this cell line are not contact-inhibited . Contact inhibition is the natural process of arresting cell growth when cells come into contact with each other.

Cell Line Origin Mouse erythroleukaemic lymphoblast Cell Line Description This cell line is a clone isolated from the parent line 745 TG-12. The cells are resistant to oubain and thioguanine and deficient in HGPRT.

Biochem/physiol Actions ABL1 protooncogene encodes a cytoplasmic and nuclear protein tyrosine kinase that has been implicated in processes of cell differentiation, cell division, cell adhesion, and stress response. Activity of ABL protein is

Cell Line Origin Mouse pituitary tumour Cell Line Description This F2 subclone was developed from original AtT-20, an andrenocorticotropic hormone (ACTH) secreting cell line established from murine pituitary tumour. These cells are readily

Cell Line Origin Mouse melanoma, producing melanin Cell Line Description Mouse melanoma which produces melanin. Application B16-F1 cell line from mouse has been used to study the cytotoxic and antioxidant properties of supercritical CO2 extract

Cell Line Origin Mouse C57BL/6J melanoma epithelial Cell Line Description Spontaneous tumour of C57 black/6J mouse originally obtained from Dr Parrish of Australian National University, Canberra. Rendered HGPRT- by selection in 20&#956g/ml

CHOZN cell lines were created utilizing Sigma&#8242s proprietary CompoZr Zinc Finger Nuclease (ZFN) technology to create genetic modifications in parental CHO-K1 cells. Cells are banked in chemically defined, animal component free EX-CELL CD CHO

Recombinant Mouse CRG-2 is produced from a DNA sequence encoding the mature mouse CRG-2/IP-10 protein sequence (MIPLARTVRCNCHIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTI KNLMKAFSQKRSKRAP). The methionyl form of the E.

Cell Line Origin Rat NEDH islet tumour Cell Line Description Established from a NEDH rat transplantable islet cell tumour. The cells secrete insulin and glucagon.

Cell Line Origin Mouse C57b1/6 T cell Cell Line Description CTLL is a subclone of T cells derived from a C57bl/6 mouse. The cells require IL-2 for growth and are used to assay for its presence in conditioned media.

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family that is also known as DCIP-1 (dendritic cell inflammatory protein-1) or MIP­2b. CXCL3 controls migration and adhesion of monocytes and mediates its

Dkk-1, His&#8226Tag , Mouse, Recombinant, consists of amino acids 30-272, fused at the C-terminus to a His&#8226Tag sequence, and expressed in NS0-dervied mouse myeloma cells. Recombinant, murine Dickkopf related protein-1 (Dkk-1), consisting of