Antibody Labeling and Modification Kits

CDC42EP1 (CDC42 effector protein 1) is a non-kinase effector protein that interacts with GTP-bound CDC42. It contains multiple proline-rich repeats and a CRIB (Cdc42/Rac interactive-binding) domain.

Immunogen CDC42 effector protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen CDC42 effector protein (Rho GTPase binding) 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to CDC42 effector protein 3 Sequence DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

CDC42EP4 (CDC42 effector protein 4) belongs to the BORG (binder of Rho GTPases) family of proteins. It is widely expressed and the gene is mapped to human chromosome 17q24-25.

Immunogen CDC42 effector protein (Rho GTPase binding) 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 effector protein (Rho GTPase binding) 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

CDHR5 (cadherin related family member 5) is a protocadherin (PCDH) family member, and is also known as PCDH24. It might be a constituent of enterocyte microvillus.

CDHR5 (cadherin related family member 5) is a protocadherin (PCDH) family member, and is also known as PCDH24. It might be a constituent of enterocyte microvillus.

Immunogen Synthetic peptide directed towards the N terminal region of human CHN2 Sequence Synthetic peptide located within the following region: AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK Physical form Purified antibody supplied in 1x PBS

The gene CHN2 (&#946-chimerin) is mapped to human chromosome 7p15.3.

Immunogen chimerin 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The