Antibody Labeling and Modification Kits

Immunogen caseinolytic mitochondrial matrix peptidase chaperone subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen contactin 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen contactin 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Collectin 11 (COLEC11) is member of C-type lectin family of proteins. The members of this family have collagen-like sequence and a calcium dependent carbohydrate recognition domain.

COLGALT1 (collagen &#946(1- O )galactosyltransferase 1), which is also known as GLT25D1 (glycosyltransferase 25 domain 1), is a soluble protein located in the ER (endoplasmic reticulum). It belongs to GT25 family, that encodes glycosyltransferase.

Immunogen cysteine-rich secretory protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene CRISPLD1 (cysteine rich secretory protein LCCL domain containing 1) is mapped to human chromosome 8q21.11.

Immunogen Recombinant protein corresponding to cysteine rich secretory protein LCCL domain containing 2 Sequence TRNGKVPFFVKSERHGVQSLSKYKPSSSFMVSKVKVQDLDCYTTVAQLCPFEKPATHCPRIHCPAHCKDEPSYWAPVFGTNIYADTSSICKTAVHAGVISNESGGDVDVMPVDK Application All

Immunogen cysteine-rich secretory protein LCCL domain containing 2 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given

Immunogen cystatin 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cystatin D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive