-
Add to Cart The item has been addedHPA042265-100ULAnti-PODXL2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen podocalyxin-like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedAV42647-100ULAnti-PP2447 antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human PP2447 Sequence Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedAB1761-IAnti-Protein Gene Product 9.5 Antibody (C15-1315-882)
Price: $852.00List Price: $946.67Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UniProt: P09936 also known as EC: 3.4. -
Add to Cart The item has been addedAB5898Anti-Protein Gene Product 9.5 Antibody (C15-1316-396)
Price: $874.29List Price: $971.43Specificity Recognizes Protein Gene Product 9.5 (PGP9. -
Add to Cart The item has been addedAB5925Anti-Protein Gene Product 9.5 Antibody (C15-1316-400)
Price: $828.00List Price: $920.00Specificity Protein Gene Product 9.5 (PGP9. -
Add to Cart The item has been addedHPA038788-100ULAnti-PRSS35 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen protease, serine, 35 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA034955-100ULAnti-PRSS53 antibody produced in rabbit (C15-1453-611)
Price: $889.20List Price: $988.00Immunogen protease, serine, 53 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA034956-100ULAnti-PRSS53 antibody produced in rabbit (C15-1453-612)
Price: $889.20List Price: $988.00Immunogen protease, serine, 53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA030783-100ULAnti-PSCA antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen prostate stem cell antigen Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA030224-100ULAnti-PSMB10 antibody produced in rabbit (C15-1452-603)
Price: $879.43List Price: $977.14Immunogen proteasome (prosome, macropain) subunit, beta type, 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA030225-100ULAnti-PSMB10 antibody produced in rabbit (C15-1452-604)
Price: $879.43List Price: $977.14Immunogen proteasome (prosome, macropain) subunit, beta type, 10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA028967-100ULAnti-PSMB11 antibody produced in rabbit (C15-1452-072)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to proteasome subunit beta 11 Sequence AADTRSSCGSYVACPASCKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRELREGQLPSVASAAKLLSAMMSQYRGLDLCVATALCGWDRSGPELFYVYSDGTRLQGDIFSVGSGSPYAYGVLDRGYRYDMSTQEAYALAR Application All
