-
HPA042881-100UL
Anti-RBM41 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen RNA binding motif protein 41 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028840-100UL
ANTI-SART3 ANTIBODY PRODUCED IN RABBIT (C15-1452-021)
Price: $977.14List Price: $1,085.71Immunogen squamous cell carcinoma antigen recognized by T cells 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA044322-100UL
Anti-SART3 antibody produced in rabbit (C15-1458-101)
Price: $928.29List Price: $1,031.43Immunogen squamous cell carcinoma antigen recognized by T cells 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA051214-100UL
Anti-SECTM1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen secreted and transmembrane 1 recombinant protein epitope signature tag (PrEST) Sequence CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAAD Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA037898-100UL
Anti-SERINC5 antibody produced in rabbit (C15-1454-964)
Price: $928.29List Price: $1,031.43Immunogen serine incorporator 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA037899-100UL
Anti-SERINC5 antibody produced in rabbit (C15-1454-965)
Price: $928.29List Price: $1,031.43Immunogen serine incorporator 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA059582-100UL
Anti-SERPINB10 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen serpin peptidase inhibitor, clade B (ovalbumin), member 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA009668-100UL
Anti-SERPINB6 antibody produced in rabbit (C15-1447-331)
Price: $879.43List Price: $977.14SERPINB6 (serpin peptidase inhibitor, clade B, member 6), also called cytoplasmic antiproteinase (CAP), is an intracellular serpin, which shows a wide range of tissue expression including platelets. It is a 70kDa member of the ovalbumin family of -
HPA012736-100UL
Anti-SERPINB6 antibody produced in rabbit (C15-1447-845)
Price: $879.43List Price: $977.14Serpin peptidase inhibitor 6 (SERPIN6) belongs to the serpin family of proteins. It is expressed in monocytes and granulocytes. -
HPA030067-100UL
Anti-SERPINB9 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen serpin peptidase inhibitor, clade B (ovalbumin), member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA055767-100UL
Anti-SERPIND1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen serpin peptidase inhibitor, clade D (heparin cofactor), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
HPA048738-100UL
Anti-SERPING1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen serpin peptidase inhibitor, clade G (C1 inhibitor), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most