Antibody Labeling and Modification Kits

Immunogen three prime repair exonuclease 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to three prime repair exonuclease 1 Sequence VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

TRMT10B (tRNA methyltransferase 10B) is a cytosolic protein belonging to the TRMT10 family. The members of this family are composed of catalytic SPOUT domain connected with N- and C-terminal helical domains.

Immunogen RNA (guanine-9-) methyltransferase domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen tRNA-(guanine-N 1 ) methyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen tumor suppressor candidate 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

H2AX is involved in DNA repair and the maintenance of genomic stability. It is been implicated both in homologous recombination and nonhomologous end joining DNA repair pathways.

Immunogen ubiquitin-fold modifier conjugating enzyme 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen ubiquitin-fold modifier conjugating enzyme 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Specificity Recognizes V5 (GKPIPNPLLGLDST). Immunogen GKPIPNPLLGLDST (V5) Application Anti-V5 Epitope Tag Antibody is an antibody against V5 Epitope Tag for use in IC, IP &amp WB.

Immunogen Protein fat-free homolog (Another new gene 2 protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen vacuolar protein sorting 51 homolog (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive