-
Add to Cart The item has been addedHPA062022-100ULAnti-VSIG10 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to V-set and immunoglobulin domain containing 10 Sequence LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA060453-100ULAnti-VSIG10L antibody produced in rabbit (C15-1463-538)
Price: $928.29List Price: $1,031.43Immunogen V-set and immunoglobulin domain containing 10 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA066745-100ULAnti-VSIG10L antibody produced in rabbit (C15-1465-133)
Price: $928.29List Price: $1,031.43Immunogen V-set and immunoglobulin domain containing 10 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA060933-100ULAnti-VTN antibody produced in rabbit (C15-1463-654)
Price: $928.29List Price: $1,031.43Immunogen vitronectin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA068011-100ULANTI-VTN ANTIBODY PRODUCED IN RABBIT (C15-1465-419)
Price: $977.14List Price: $1,085.71Immunogen vitronectin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA023026-100ULAnti-WRAP53 antibody produced in rabbit (C15-1450-219)
Price: $879.43List Price: $977.14WRAP53 (WD repeat containing, antisense to TP53) can result in three isoforms: α, β and γ. It is present in Cajal bodies. -
Add to Cart The item has been addedHPA028130-100ULAnti-WRAP53 antibody produced in rabbit (C15-1451-721)
Price: $879.43List Price: $977.14Immunogen WD repeat containing, antisense to TP53 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA029928-100ULAnti-WRAP53 antibody produced in rabbit (C15-1452-472)
Price: $879.43List Price: $977.14Immunogen WD repeat containing, antisense to TP53 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
-
-
-
