Antibody Labeling and Modification Kits

CCDC51 (Coiled-coil domain-containing protein 51) is an uncharacterized coiled-coil domain protein belonging to the evolutionarily conserved coiled-coil domain-containing protein family. Generally, it plays a role in the homodimerization and helps

CCDC57 (coiled-coil domain containing 57) protein contains a coiled coil domain. The gene is mapped to human chromosome 17q25.

CCDC57 (coiled-coil domain containing 57) protein contains a coiled coil domain. The gene is mapped to human chromosome 17q25.

Immunogen Coiled-coil domain-containing protein 57 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The gene CCDC57 (coiled-coil domain containing 57) is mapped to human chromosome 17q25.3.

Immunogen Coiled-coil domain-containing protein 90B, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

CCDC90B (Coiled-coil domain containing 90B) is a mitochondrial protein. Its molecular function is unclear.

Immunogen chemokine (C-C motif) receptor 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen chemokine (C-C motif) receptor 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen CD109 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to CD109 molecule Sequence GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA Application All Prestige Antibodies

Specificity This antibody recognizes both the soluble and membrane bound human IL-6 receptor. The antibody will inhibit IL-6 mediated proliferation of XG-1 cells and partially blocks the binding of IL-6 to its receptor.