Protein A Products

The two major cytoskeletal proteins implicated in cell motility are actin and myosin. Actin and myosin are involved in a myriad of cellular processes including locomotion, secretion, cytoplasmic streaming, phagocytosis, and cytokinesis.

A549 Cells HIF1A -/-/- are lung carcinoma, epithelial cells, from a human caucasian male (aged 58 years), with a ZFN knock out modification. This product corresponds to ATCC Cat.

Immunogen Recombinant protein corresponding to ArfGAP with coiled-coil, ankyrin repeat and PH domains 1 Sequence QGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQRHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFK Application All Prestige Antibodies Powered by Atlas Antibodies

Immunogen Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application Anti-ACBD5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen acyl-CoA synthetase medium-chain family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Acyl-CoA synthetase medium chain family member 3 (ACSM3), also known as SAH (spontaneously hypertensive rat-clone A-hypertension–associated), is encoded by the gene mapped to human chromosome 16p13.11.

Immunogen acyl-CoA synthetase medium-chain family member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen acyl-CoA synthetase medium-chain family member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Actin, aortic smooth muscle (UniProt P62736 also known as Alpha-actin-2, Cell growth-inhibiting gene 46 protein) is encoded by the ACTA2 (also known as AAT6, ACTSA, ACTVS, GIG46, MYMY5) gene (Gene ID 59) in human. Actins are globular

Immunogen &#945-Actinin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen aminoacylase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the