Rufocromomycin or streptonigrin

[(R,R)-Teth-TsDpen RuCl]

[(R,R)-Teth-TsDpen RuCl]

60S ribosomal protein L5 (UniProt P46777 also known as RPL5) is encoded by the RPL5 (also known as DBA6, MSTP030) gene (Gene ID 6125) in human. Ribosomal proteins (RPs) are normally involved in the assembly of the translational machinery-ribosomes

G protein-regulated inducer of neurite outgrowth 1 (UniProt Q7Z2K8 also known as GRIN1) is encoded by the GPRIN1 (also known as KIAA1893) gene (Gene ID 114787) in human. Originally identified as a binding protein for guanosine

RBPJL (SUHL or RBPSUHL) is the human homolog of Drosophila Suppressor of Hairless. Mouse Rbpj functions as a transcription factor and modulates the Notch signaling pathway to maintain neural progenitors.

Immunogen Recombinant protein corresponding to regulator of G-protein signaling 20 Sequence MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Ribosomal protein L3 is a cytoplasmic protein that can bind to HIV-1 TAR mRNA and modulated transactivation mediated by Tat. Studies have reported that the autoregulatory circuit of RPL3 required KHSRO, NPM and H1 proteins .

Immunogen 60S ribosomal protein L9 recombinant protein epitope signature tag (PrEST) Application Anti-RPL9 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen ribosomal protein S25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

BabyWipe 7x8 SftPk/Stkr Unscen, 40/pk, 24pk/cs - CS/960