Antiviral drugs

Immunogen ets variant 7 recombinant protein epitope signature tag (PrEST) Application Anti-ETV7 has been used in western blotting and immunohistochemistry. Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively

Immunogen Recombinant protein corresponding to ETS variant 7 Sequence EGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Fas ligand (TNF superfamily, member 6) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Fibrillin-1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

IgG receptor FcRn large subunit p51 (UniProt: Q61559 also known as FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor) is encoded by the Fcgrt (also known as Fcrn) gene (Gene ID: 14132) in murine species. FcRn is a

IgG receptor FcRn large subunit p51 (UniProt: Q61559 also known as FcRn, IgG Fc fragment receptor transporter alpha chain, Neonatal Fc receptor) is encoded by the Fcgrt (also known as Fcrn) gene (Gene ID: 14132) in murine species. FcRn is a

Immunogen Recombinant protein corresponding to formin binding protein 1 Sequence DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Farnesyltransferase, CAAX box, &#945 (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal

Mouse monoclonal antibody purified by ammonium sulfate precipitation and DEAE column chromatography. Recognizes the ~240 kDa &#945-subunit of intracellular and plasma membrane-associated fodrin.

Immunogen chromosome 16 open reading frame 63 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen FOS-like antigen 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen forkhead box O3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.