Fosamprenavir

Immunogen Calmodulin-regulated spectrin-associated protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Charged multivesicular body protein 3 (UniProt: Q9Y3E7 also known as Chromatin-modifying protein 3, CHMP3, Neuroendocrine differentiation factor, Vacuolar protein sorting-associated protein 24, hVps24) is encoded by the CHMP3 (also known as

Charged multivesicular body protein 3 (UniProt: Q9Y3E7 also known as Chromatin-modifying protein 3, CHMP3, Neuroendocrine differentiation factor, Vacuolar protein sorting-associated protein 24, hVps24) is encoded by the CHMP3 (also known as

Farnesyltransferase, CAAX box, &#945 (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal

Mouse monoclonal antibody purified by ammonium sulfate precipitation and DEAE column chromatography. Recognizes the ~240 kDa &#945-subunit of intracellular and plasma membrane-associated fodrin.

Immunogen MPV17 mitochondrial membrane protein-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen phospholipid phosphatase related 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Anti-RPGR retinitis pigmentosa GTPase regulator, 100ul UN 16

Anti-RPGR retinitis pigmentosa GTPase regulator, 25ul UN 168

Immunogen Recombinant protein corresponding to ribosomal protein S19 Sequence LYLRGGAGVGSMTKIYGGRQRNGVMPSHFSRGSKSVARRVLQAPEGLKMVEKDQDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen MEI5 meiotic recombination protein homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

HLA-B*3501 restricted influenza virus nucleoprotein epitope (383-391).