Immunomodulating drugs

Cell Line Origin Mouse P3X63Ag8 x Mouse BALB/cj spleen Cell Line Description The antibody is directed against the CD5 antigen. Immunogen Human peripheral blood lymphocytes Culture Medium IDMEM + 2mM glutamine + 20% Foetal Bovine Serum (FBS)

Anti-CD54, mouse monoclonal, clone 15.2, recognizes D1 domain of the ~90 kDa CD54 (ICAM-1) in Raji cells.

Immunogen Immunogen Sequence: GI # 10835143 , sequence 36-129 Recombinant decay accelerating factor for complement Application Anti-CD55 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or

Immunogen CD81 antigen recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Anti-Cdh1 (Ab-2), mouse monoclonal, clone DH01, recognizes the ~55 kDa Cdh-1 protein in Rat-1 cells. It is validated for Western blotting and immunoprecipitation.

Immunogen Epithelial-cadherin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

CDH20 (cadherin 20), also called CDH7L3, is identical to mouse cadherin-7, and is most probably a Xenopus F-cadherin ortholog. This gene is localized to human chromosome 18q22-q23.

Immunogen Cadherin-4 precursor recombinant protein epitope signature tag (PrEST) Sequence YLIDINDNAPELLPKEAQICERPNLNAINITAADADVDPNIGPYVFELPFVPAAVRKNWTITRLNGDYAQLSLRILYLEAGMYDVPIIVTDSGNPPLSNTSIIKVKVCPCD Application All Prestige Antibodies Powered by

Immunogen cadherin 7, type 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen CDV3 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen CDV3 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen CDV3 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by