-
Add to Cart The item has been addedHPA077103-100ULImmunogen Recombinant protein corresponding to testis specific serine kinase 4 Sequence DFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedAV37392-100ULTTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans. -
Add to Cart The item has been addedHPA023010-25ULTTC19 (tetratricopeptide repeat domain 19) contains 380 amino acids present in the inner mitochondrial membrane. The gene is mapped to human chromosome 17p12. -
Add to Cart The item has been addedHPA023908-100ULImmunogen Tetratricopeptide repeat domain 25 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA030048-100ULImmunogen Recombinant protein corresponding to TTN Sequence HFLSILTIDTSDAEDYSCVLVEDENVKTTAKLIVEGAVVEFVKELQDIEVPESYSGELECIVSPENIEGKWYHNDVELKSNGKYTITSRRGRQNLTVKDVTKEDQGEYSFVIDGKKTTCKLKMK Application All Prestige Antibodies Powered by Atlas Antibodies -
Add to Cart The item has been addedABC1434UV radiation resistance-associated gene protein (UniProt: Q9P2Y5 also known as p63) is encoded by UVRAG gene (Gene ID: 7405) in human. UVRAG is a key autophagic tumor suppressor that is shown to be mutated in several common human cancers. -
Add to Cart The item has been added218210-10GThomas Scientific
Antimony shot, 1-3mm, 99.9999% trace metals basis 10g
Price: $153.90List Price: $171.00CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added218210-250GThomas Scientific
Antimony shot, 1-3mm, 99.9999% trace metals basis 250g
Price: $1,449.57List Price: $1,610.63CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added132015-25GThomas Scientific
Antimony shot, 1.5-5mm, 99.9999% trace metals basis 25g
Price: $275.63List Price: $306.25CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added217180-100GThomas Scientific
Antimony shot, 6mm, 99.999% trace metals basis 100g
Price: $478.81List Price: $532.01CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added217180-25GThomas Scientific
Antimony shot, 6mm, 99.999% trace metals basis 25g
Price: $187.08List Price: $207.87CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69 -
Add to Cart The item has been added217180-500GThomas Scientific
Antimony shot, 6mm, 99.999% trace metals basis 500g
Price: $1,639.23List Price: $1,821.36CAS: 7440-36-0 EC No: 231-146-5 MDL No: MFCD00134030 RTECS: CC4025000 Solid Molecular Formula: Sb MW: 121.76 Melting Point: 630° Boiling Point: 1635° Density (g/mL): 6.69
