Technetium Tc-99m/99mtc teboroxime

Immunogen tensin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen tensin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen Synthetic peptide directed towards the middle region of human TSG101 Biochem/physiol Actions TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of

Immunogen Recombinant protein corresponding to testis specific serine kinase 4 Sequence DFGFAKMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPEILRGLPYNPFLSDTWS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

TTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans.

TTC19 (tetratricopeptide repeat domain 19) contains 380 amino acids present in the inner mitochondrial membrane. The gene is mapped to human chromosome 17p12.

BSA+TMCS combination, is one of the most commonly used silylating reagents. BSA is readily used for silylating a wide range of functional groups such as non-sterically hindered alcohols, amides, amines, amino acids, carboxylic acids, and enols.

Chromeo P503 labels proteins and peptides by exhibiting a color change from blue to red upon binding to primary amines. Chromeo P503 displays a weak fluorescence with a quantum yield &lt1% in solution.

Application The uniqueness of D.E.

Application The uniqueness of D.E.

DMT-2&#8242O-TBDMS-rA(bz) Phosphoramidite belongs to the group of 2&#8242O-TBDMS RNA Phosphoramidites. Application RNA interference (RNAi) has become a popular tool for the sequence-specific inhibition of gene expression and can be used in target

DMT-2&#8242O-TBDMS-rA(bz) Phosphoramidite belongs to the group of 2&#8242O-TBDMS RNA Phosphoramidites. Application RNA interference (RNAi) has become a popular tool for the sequence-specific inhibition of gene expression and can be used in target