Eukaryotic Cells

Immunogen Recombinant fragment corresponding to a region within amino acids 236 and 562 of POM121 according to NP_742017 Application Suggested starting dilutions are as follows: ICC/IF: 1:100-1:1000, IHC-P: 1:100-1:1000, WB: 1:500-1:3000. Not

Anti-PRICKLE3 prickle homolog 3 (Drosophila), 100ul UN 1687

Anti-PRICKLE3 prickle homolog 3 (Drosophila), 25ul UN 1687 6

RBPJL (SUHL or RBPSUHL) is the human homolog of Drosophila Suppressor of Hairless. Mouse Rbpj functions as a transcription factor and modulates the Notch signaling pathway to maintain neural progenitors.

General description Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis (PubMed:1944575, PubMed:17435751,

SMC3 codes for a part of the cohesion complex that regulates chromosome segregation during mitosis. It is known to form a heterodimer with SMC1, which subsequently can restructure the double helical form of DNA into a series of loops.

General description Stage-specific embryonic antigen 3 (SSEA-3) is a glycosphingolipid composed of five carbohydrate units connected to a sphingolipid. Sphingolipids are key players in cell signaling and the SSEA-3 is a well known marker of stem

General description STRO-1 is a cell surface protein expressed by bone marrow stromal cells and erythroid precursors. The frequency of colony forming units fibroblasts (CFU-F) was enriched 100-fold in the STRO-1+/Glycophorin A- population from

Transforming acidic coiled-coil-containing protein 3 (UniProt Q9Y6A5 also known as ERIC-1 and AINT) is encoded by the TACC3 (also known as ERIC1) gene (Gene ID 10460) in human. Human TACC3 gene localizes close to the FGFR3 gene in 4p16, a region

Immunogen Recombinant protein corresponding to TAL bHLH transcription factor 1, erythroid differentiation factor Sequence PDDLLQDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADG Application All Prestige Antibodies Powered by Atlas Antibodies are

The gene TMEM43 (transmembrane protein 43, also protein LUMA) is mapped to human chromosome 3p25.1.

Anti-TRAM2 translocation associated membrane protein 2, 100u