-
Add to Cart The item has been added01051619-DNA-5UG1301 T CELL LEUKAEMIA DNA
Price: $729.73List Price: $810.811301 T CELL LEUKAEMIA DNA -
Add to Cart The item has been added85090402-1VLA431 CELLS HUMAN SQUAMOUS CARCINOMA (C005B-234459)
Price: $1,053.43List Price: $1,170.48Cell Line Origin Human squamous carcinoma Cell Line Description Derived from an epidermal carcinoma of the vulva taken from an 85 yr old female. The cells carry large numbers of EGF binding sites and is an indicator cell for anti-TGF binding. -
Add to Cart The item has been addedHPA019035-100ULANTI-ABCB11 (C005B-204958)
Price: $1,066.53List Price: $1,185.03ABCB11 is a transport protein that regulates the export of bile salts in the liver. Genetic mutations in ABCB11 have been associated with intrahepatic cholestasis, whereas overexpression of ABCB11 has been linked to obesity and hypercholesterolemia -
Add to Cart The item has been addedHPA043533-100ULANTI-AP5S1 (C005B-213191)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to adaptor related protein complex 5 sigma 1 subunit Sequence ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA069849-100ULANTI-ARL5C ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen ADP-ribosylation factor-like 5C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA030830-100ULANTI-ATP11C (C005B-208484)
Price: $959.88List Price: $1,066.53ATP11C (ATPase phospholipid transporting 11C) is an important flippase in human erythrocytes. It belongs to the P-IV ATPase family of proteins. -
Add to Cart The item has been addedHPA016629-100ULANTI-C5AR2
Price: $959.88List Price: $1,066.53Immunogen C5a anaphylatoxin chemotactic receptor C5L2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA043779-100ULANTI-C5ORF51 ANTIBODY PRODUCED IN RABBIT (C005B-213316)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 5 open reading frame 51 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA063816-100ULANTI-C5ORF51 (C005B-219749)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 5 open reading frame 51 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA040937-100ULANTI-CASP5 (C005B-211916)
Price: $1,013.20List Price: $1,125.78Immunogen caspase 5, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
Add to Cart The item has been addedHPA000252-100ULANTI-CDK5R1 (C005B-201016)
Price: $959.88List Price: $1,066.53Immunogen cyclin-dependent kinase 5, regulatory subunit 1 (p35) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA044735-100ULANTI-CT45A1 ANTIBODY PRODUCED IN RABBIT (C005B-213694)
Price: $1,013.20List Price: $1,125.78Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
