-
01051619-DNA-5UG1301 T CELL LEUKAEMIA DNA
Price: $815.80List Price: $906.441301 T CELL LEUKAEMIA DNA -
85090402-1VLA431 CELLS HUMAN SQUAMOUS CARCINOMA (C005B-234459)
Price: $1,141.37List Price: $1,268.19Cell Line Origin Human squamous carcinoma Cell Line Description Derived from an epidermal carcinoma of the vulva taken from an 85 yr old female. The cells carry large numbers of EGF binding sites and is an indicator cell for anti-TGF binding. -
HPA019035-100ULANTI-ABCB11 (C005B-204958)
Price: $1,101.69List Price: $1,224.10ABCB11 is a transport protein that regulates the export of bile salts in the liver. Genetic mutations in ABCB11 have been associated with intrahepatic cholestasis, whereas overexpression of ABCB11 has been linked to obesity and hypercholesterolemia -
HPA043533-100ULANTI-AP5S1 (C005B-213191)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to adaptor related protein complex 5 sigma 1 subunit Sequence ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA069849-100ULANTI-ARL5C ANTIBODY PRODUCED IN RABBIT
Price: $1,210.58List Price: $1,345.09Immunogen ADP-ribosylation factor-like 5C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA030830-100ULANTI-ATP11C (C005B-208484)
Price: $1,210.58List Price: $1,345.09ATP11C (ATPase phospholipid transporting 11C) is an important flippase in human erythrocytes. It belongs to the P-IV ATPase family of proteins. -
HPA016629-100ULANTI-C5AR2
Price: $1,210.58List Price: $1,345.09Immunogen C5a anaphylatoxin chemotactic receptor C5L2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA043779-100ULANTI-C5ORF51 ANTIBODY PRODUCED IN RABBIT (C005B-213316)
Price: $1,210.58List Price: $1,345.09Immunogen chromosome 5 open reading frame 51 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA063816-100ULANTI-C5ORF51 (C005B-219749)
Price: $1,210.58List Price: $1,345.09Immunogen chromosome 5 open reading frame 51 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA040937-100ULANTI-CASP5 (C005B-211916)
Price: $1,210.58List Price: $1,345.09Immunogen caspase 5, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA000252-100ULANTI-CDK5R1 (C005B-201016)
Price: $1,210.58List Price: $1,345.09Immunogen cyclin-dependent kinase 5, regulatory subunit 1 (p35) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA044735-100ULANTI-CT45A1 ANTIBODY PRODUCED IN RABBIT (C005B-213694)
Price: $1,210.58List Price: $1,345.09Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
Cancer antigen 125 tests
Browse our curated selection of Cancer antigen 125 tests from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
About Cancer antigen 125 tests
Cenmed Enterprises provides a comprehensive selection of Cancer antigen 125 tests products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.



