-
Add to Cart The item has been addedHPA044757-100ULANTI-CT45A1 ANTIBODY PRODUCED IN RABBIT (C005B-213702)
Price: $1,013.20List Price: $1,125.78Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA046872-100ULANTI-CT45A1 ANTIBODY PRODUCED IN RABBIT (C005B-214447)
Price: $1,013.20List Price: $1,125.78Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA046987-100ULANTI-CT45A1 ANTIBODY PRODUCED IN RABBIT (C005B-214490)
Price: $1,013.20List Price: $1,125.78Immunogen cancer/testis antigen family 45, member A1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA000387-100ULANTI-CTAGE5 (C005B-201039)
Price: $959.88List Price: $1,066.53The previously assigned protein identifier O15320 has been merged into Q96PC5. Full details can be found on the UniProt database. -
Add to Cart The item has been addedHPA058547-100ULANTI-CYB5A ANTIBODY PRODUCED IN RABBIT (C005B-218279)
Price: $1,013.20List Price: $1,125.78Cytochrome b5 (CYB5A) gene codes for cytochrome b5 protein. It is located on human chromosome 18. -
Add to Cart The item has been addedHPA055872-100ULANTI-CYP20A1 ANTIBODY PRODUCED IN RABBIT (C005B-217477)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 20, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA058461-100ULANTI-CYP20A1 ANTIBODY PRODUCED IN RABBIT (C005B-218252)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 20, subfamily A, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA069248-100ULANTI-CYP2S1 (C005B-220867)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to cytochrome P450 family 2 subfamily S member 1 Sequence GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA017265-100ULANTI-CYP4F11
Price: $959.88List Price: $1,066.53CYP4F11 (cytochrome P450, family 4, subfamily F, polypeptide 11) is a cytochrome P450 4F isoform belonging to the CYP4 family and CYP4A subfamily. In humans, it is expressed in liver, heart, kidney, and skeletal muscles. -
Add to Cart The item has been addedHPA056837-100ULANTI-DOCK5 (C005B-217778)
Price: $1,013.20List Price: $1,125.78Immunogen dedicator of cytokinesis 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedGR15-100UGANTI-EGFR (AB-5) MOUSE MAB (EGFR.1) (C005B-200302)
Price: $860.00List Price: $955.55Anti-EGFR (Ab-5), mouse monoclonal, clone EGFR.1, recognizes the ~170 kDa EGF receptor protein in A431 cells. -
Add to Cart The item has been addedHPA023279-100ULANTI-ELP5 (C005B-206057)
Price: $959.88List Price: $1,066.53The gene ELP5 (elongator acetyltransferase complex subunit 5) is mapped to human chromosome 17p13. It is widely expressed and shows high expression in the heart, brain, liver, skeletal muscle and testis.
