-
HPA000791-100ULANTI-ICK (C005B-201154)
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to intestinal cell kinase Sequence DFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSS Application All Prestige Antibodies Powered by -
HPA047014-100ULANTI-ST14 (C005B-214497)
Price: $1,101.69List Price: $1,224.10Immunogen suppression of tumorigenicity 14 (colon carcinoma) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
DTG-MAILERSCLARITY DIAGNOSTICS COLON CANCER SCREENING (C001B-027958)
Price: $101.45List Price: $112.72Clarity Specimen Collection Mailer Kit, Includes: (50) Envelopes, (50) Collection Papers, (50) Instruction Sheets, For Use with Clarity FIT Testing Kits, 50/bx -
DTG-FOB01CLARITY DIAGNOSTICS COLON CANCER SCREENING (C001B-027960)
Price: $180.52List Price: $200.57Clarity Fecal Occult Blood Test Kit, CLIA Waived, Includes: (30) Test Cassettes, (35) Collection Tubes, External Controls (1 Each of +/- .5mL Bottle), Product Insert, 30/bx -
DTG-FOBCTLSCLARITY DIAGNOSTICS COLON CANCER SCREENING (C001B-027963)
Price: $69.42List Price: $77.13Clarity iFOB Controls, 1/bx -
EK700429Human colon cancer-specific antigen-2(CCSA-2) Elisa Kit
Price: $1,226.89List Price: $1,363.21Species : Human Assay Principle : Quantitative Target Name : colon cancer-specific antigen-2 Sensitivity : 0.01 ng/mL Detection Range : 0.2ng/mL -13 ng/mL -
EK711269Human Pancreastatin Elisa Kit
Price: $1,226.89List Price: $1,363.21Species : Human Assay Principle : Quantitative Target Name : Pancreastatin Sensitivity : 1.5 pg/ml Detection Range : 8 pg/ml -400 pg/ml -
EK711357Human pulmonary activation regulated chemokine(PARC) Elisa Kit
Price: $1,226.89List Price: $1,363.21Species : Human Assay Principle : Quantitative Target Name : pulmonary activation regulated chemokine Sensitivity : 8.0 pg/ml Detection Range : 30 pg/ml -1000 pg/ml -
IT10642Immunotag Bovine Serologically defined colon cancer antigen 3 homolog ELISA Kit
Price: $1,561.92List Price: $1,735.47Immunotag™ Bovine Serologically defined colon cancer antigen 3 homolog ELISA Kit -
ITT2375-100u-647Immunotag Intestinal Cell Kinase Polyclonal Antibody-Alexa Fluor® 647* (C009B-337294)
Price: $842.33List Price: $935.93Immunotag™ Intestinal Cell Kinase Polyclonal Antibody-Alexa Fluor® 647* -
ITT2375-50u-647Immunotag Intestinal Cell Kinase Polyclonal Antibody-Alexa Fluor® 647* (C009B-337304)
Price: $566.16List Price: $629.06Immunotag™ Intestinal Cell Kinase Polyclonal Antibody-Alexa Fluor® 647* -
SMB95-2018Microsart Validation Standard Achole
Price: $735.34List Price: $817.05<p>European Pharmacopoeia 2.6.
Colon cancer nat tests
Browse our curated selection of Colon cancer nat tests from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
About Colon cancer nat tests
Cenmed Enterprises provides a comprehensive selection of Colon cancer nat tests products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.



