-
212-545-082Alexa Fluor 488 AffiniPure Mouse Anti-Rat IgG (H+L) (min X Ms Sr Prot), 1 mg
Price: $571.97List Price: $635.53Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. -
212-585-082Alexa Fluor 594 AffiniPure Mouse Anti-Rat IgG (H+L) (min X Ms Sr Prot), 1 mg
Price: $571.97List Price: $635.53Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. -
209-605-082Alexa Fluor 647 AffiniPure Mouse Anti-Human IgG (H+L) (min X Ms Sr Prot), 1 mg
Price: $571.97List Price: $635.53Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. -
212-605-082Alexa Fluor 647 AffiniPure Mouse Anti-Rat IgG (H+L) (min X Ms Sr Prot), 1 mg
Price: $571.97List Price: $635.53Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. -
312-605-003Alexa Fluorr 647 AffiniPure Rabbit Anti-Rat IgG (H+L), 1 mg
Price: $342.34List Price: $380.38Whole IgG antibodies are isolated as intact molecules from antisera by immunoaffinity chromatography. They have an Fc portion and two antigen binding Fab portions joined together by disulfide bonds and therefore they are divalent. -
Add to Cart The item has been addedHPA074550-100ULANTI-ADAM11
Price: $1,210.58List Price: $1,345.09Immunogen Recombinant protein corresponding to ADAM metallopeptidase domain 11 Sequence LPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA065701-100ULANTI-AR
Price: $1,039.98List Price: $1,155.53Immunogen androgen receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA030502-100ULANTI-ASF1A (C005B-208356)
Price: $1,101.69List Price: $1,224.10Immunogen anti-silencing function 1A histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071495-100ULANTI-ASF1A (C005B-221271)
Price: $1,101.69List Price: $1,224.10Immunogen anti-silencing function 1A histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA055069-100ULANTI-ATF1 ANTIBODY PRODUCED IN RABBIT (C005B-217208)
Price: $1,101.69List Price: $1,224.10Immunogen activating transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedDR1086-100UGANTI-ATF3 MOUSE MAB (6B8)
Price: $1,040.03List Price: $1,155.59Anti-ATF3, mouse monoclonal, clone 6B8, recognizes the human ATF3 protein. It is validated for ELISA and Western blotting. -
Add to Cart The item has been added200-303-400Anti-ATM Protein Kinase pS1981 (MOUSE) Monoclonal Antibody Peroxidase Conjugated, 100 g, Lyophilized
Price: $1,913.79List Price: $2,126.43This product has been tested by ELISA, IF, and western blotting against both the native and recombinant forms of the protein. This reagent may also be suitable for immunoperoxidase electron microscopy and immunohistochemistry as well as other
Cypress allergenic extracts
Browse our curated selection of Cypress allergenic extracts from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Cypress allergenic extracts
Cenmed Enterprises provides a comprehensive selection of Cypress allergenic extracts products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.