-
Add to Cart The item has been addedMAB8674ANTI-HERPES SIMPLEX VIRUS 1 ANTIBODY CLONE 13D11
Price: $617.09List Price: $685.65General description UL42 is the DNA polymerase accessory protein of herpes simplex virus type 1. Specificity Clone 13D11 is specific for the UL42 protein of HSV1 Immunogen Baculovirus-expressed HSV DNA polymerase (POL) and POL/UL42 complex. -
Add to Cart The item has been added05-588ANTI-HET/SAF-B ANTIBODY CLONE 6F7
Price: $829.44List Price: $921.60Specificity HET/SAF-B Immunogen Peptide corresponding to residues 345-357 of human HET/SAF-B Application Anti-HET/SAF-B Antibody, clone 6F7 is a high quality Mouse Monoclonal Antibody for the detection of HET/SAF-B &: has been validated in -
Add to Cart The item has been added07-594ANTI-HISTONE H2A.Z ANTIBODY (C005B-244755)
Price: $1,056.31List Price: $1,173.68Specificity Broad species cross-reactivity is expected C-terminus of histone H2A.Z Immunogen peptide containing the sequence SLIGKKGQQ, corres-ponding to the C-terminus of human histone H2A. -
Add to Cart The item has been added07-594-25ULANTI-HISTONE H2A.Z ANTIBODY (C005B-244756)
Price: $349.98List Price: $388.86Specificity Broad species cross-reactivity is expected C-terminus of histone H2A.Z Immunogen peptide containing the sequence SLIGKKGQQ, corres-ponding to the C-terminus of human histone H2A. -
Add to Cart The item has been addedHPA044855-100ULANTI-HKR1 (C005B-213735)
Price: $1,013.20List Price: $1,125.78Immunogen HKR1, GLI-Kruppel zinc finger family member Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035480-100ULANTI-HNMT ANTIBODY PRODUCED IN RABBIT (C005B-209461)
Price: $1,013.20List Price: $1,125.78Immunogen histamine N-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA073754-100ULANTI-HNMT ANTIBODY PRODUCED IN RABBIT (C005B-221655)
Price: $1,066.53List Price: $1,185.03Immunogen histamine N-methyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedSAB2107858-100ULANTI-HOXA10 (C005B-330486)
Price: $785.86List Price: $873.18Immunogen Synthetic peptide directed towards the N terminal region of human HOXA10 Sequence Synthetic peptide located within the following region: MSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAHGGVYLPP Physical form Purified antibody supplied in -
Add to Cart The item has been addedHPA031518-100ULANTI-HSCB (C005B-208767)
Price: $970.54List Price: $1,078.38Immunogen HscB mitochondrial iron-sulfur cluster co-chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedA02213-100Anti-Human CD28 Antibody (F105), mAb, Mouse
Price: $159.76List Price: $177.51The product is specific for human CD28. -
Add to Cart The item has been addedA02211-100Anti-Human CD4 Antibody (F001), mAb, Mouse
Price: $159.76List Price: $177.51The product is specific for human CD4. -
Add to Cart The item has been addedA02212-100Anti-Human CD8 Antibody (F002), mAb, Mouse
Price: $159.76List Price: $177.51The product is specific for human CD8.
