-
Add to Cart The item has been addedSAB1410711-100UGANTI-IL9 ANTIBODY PRODUCED IN RABBIT
Price: $1,041.83List Price: $1,157.59General description The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. -
Add to Cart The item has been addedEK712908Human Lipase member I(LIPI) Elisa Kit
Price: $1,226.89List Price: $1,363.21Species : Human Assay Principle : Target Name : Lipase member I Sensitivity : Detection Range : -
Add to Cart The item has been addedRC212-20.SIZE.10ugIL-9, Human, 10ug (C003B-355423)
Price: $504.78List Price: $560.87IL-9, human: Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) -
Add to Cart The item has been addedRC212-20.SIZE.1mgIL-9, Human, 1mg (C003B-356087)
Price: $13,998.85List Price: $15,554.28IL-9, human: Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) -
Add to Cart The item has been addedRC212-20.SIZE.2ugIL-9, Human, 2ug
Price: $307.36List Price: $341.51IL-9, human: Interleukin-9 (IL-9) is encoded by the IL9 gene and produced by T-cells and specifically by CD4+ helper cells. IL-9 was originally identified as a cytokine found in the conditioned medium of a human T cell leukemia virus type I (HTLVI) -
Add to Cart The item has been addedIT8239Immunotag Mouse 15-LO/LOX (15-lipoxygenase) ELISA, 96 well plate
Price: $2,081.63List Price: $2,312.92A 15-LO/LOX (15-lipoxygenase) ELISA with a senstivity of 0.094ng/ml and a range of 0.156-10ng/ml. Uses the detection method Sandwich ELISA, Double Antibody -
Add to Cart The item has been addedIT15778Immunotag Mouse Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial ELISA Kit
Price: $1,561.92List Price: $1,735.47Immunotag™ Mouse Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial ELISA Kit -
Add to Cart The item has been addedIT13581Immunotag Mouse Thiomorpholine-carboxylate dehydrogenase ELISA Kit
Price: $1,561.92List Price: $1,735.47Immunotag™ Mouse Thiomorpholine-carboxylate dehydrogenase ELISA Kit -
Add to Cart The item has been addedSAB5201357-100UGMONOCLONAL ANTI-ATAXIN - ATTO 390 ANTIBODY PRODUCED IN MOUSE
Price: $1,187.33List Price: $1,319.25Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). -
Add to Cart The item has been addedSAB5201358-100UGMONOCLONAL ANTI-ATAXIN - ATTO 488 ANTIBODY PRODUCED IN MOUSE
Price: $1,187.33List Price: $1,319.25Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). -
Add to Cart The item has been addedSAB5201360-100UGMONOCLONAL ANTI-ATAXIN - ATTO 594 ANTIBODY PRODUCED IN MOUSE
Price: $1,187.33List Price: $1,319.25Immunogen Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). -
Add to Cart The item has been addedSAB5201681-100UGMONOCLONAL ANTI-ATAXIN 1 - ATTO 390 ANTIBODY PRODUCED IN MOUSE
Price: $1,187.33List Price: $1,319.25Immunogen Synthetic peptide amino acids 746-761 (RKRRWSAPETRKLEKS) of mouse ataxin-1. Rat: 93% identity (15/16 amino acids identical).
Marshelder allergenic extracts
Browse our curated selection of Marshelder allergenic extracts from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Marshelder allergenic extracts
Cenmed Enterprises provides a comprehensive selection of Marshelder allergenic extracts products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.