-
Add to Cart The item has been addedSAB4501488-100UGANTI-GPR109 ANTIBODY PRODUCED IN RABBIT
Price: $1,005.90List Price: $1,117.67General description Anti-GPR109 antibody detects endogenous levels of total GPR109 protein. GPR109B (G-protein coupled receptor 109B) is also called as hydroxycarboxylic acid receptor 3 (HCA3) and HM74 (G-protein coupled receptor). -
Add to Cart The item has been addedZRB2184-4X25ULANTI-GSDME/DFN5 CLONE 1H7 ZOOMAB RABBIT MONOCLONAL (C005B-260751)
Price: $927.84List Price: $1,030.94General description ZooMAb ®: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb ®: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and -
Add to Cart The item has been addedZRB2184-25ULANTI-GSDME/DFN5 CLONE 1H7 ZOOMAB RABBIT MONOCLONAL (C005B-260752)
Price: $477.44List Price: $530.49General description ZooMAb ®: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb ®: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and -
Add to Cart The item has been addedSAB2109161-100ULANTI-MC2R (N-TERMINAL) ANTIBODY PRODUCED IN RABBIT
Price: $833.46List Price: $926.07General description MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). -
Add to Cart The item has been addedSAB2103703-100ULANTI-MPEG1 (C005B-476314)
Price: $1,041.83List Price: $1,157.59Immunogen Synthetic peptide directed towards the middle region of human MPEG1 Sequence Synthetic peptide located within the following region: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP Physical form Purified antibody supplied in 1x -
Add to Cart The item has been addedMAB1548ANTI-MYOSIN ANTIBODY HEAVY CHAIN BETA
Price: $932.26List Price: $1,035.84Specificity Recognizes the S1/S2 junction of human ventricular myosin heavy chain beta Immunogen Epitope: heavy chain beta Human ventricular myosin Application Detect Myosin using this Anti-Myosin Antibody, heavy chain β: validated for -
Add to Cart The item has been addedP7857-.05MLANTI-P2X1 PURINERGIC RECEPTOR DEVELOPED IN RABBIT AFFINITY ISOLATED ANTIBODY
Price: $608.93List Price: $676.59Immunogen synthetic peptide corresponding to amino acids 382-399 of rat P2X 1 (with additional N-terminal cysteine and serine). The epitope is highly conserved in mouse and human. -
Add to Cart The item has been addedAB8123ANTI-PHOSPHO-INTEGRIN BETA1 (THR788/789) ANTIBODY (C005B-240275)
Price: $889.33List Price: $988.15Specificity Integrin B1 phosphorylated on Thr788/789 Immunogen C-terminal Peptide Application Research Category Cell Structure Research Sub Category Integrins This Anti-phospho-Integrin ⓵ (Thr788/789) Antibody is validated for use in WB for -
Add to Cart The item has been addedAV42647-100ULANTI-PP2447
Price: $880.17List Price: $977.96Immunogen Synthetic peptide directed towards the N terminal region of human PP2447 Sequence Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK Physical form Purified antibody supplied in 1x PBS -
Add to Cart The item has been addedAV40276-100ULANTI-SNRP70 (C005B-099039)
Price: $880.17List Price: $977.96Immunogen Synthetic peptide directed towards the N terminal region of human SNRP70 Biochem/physiol Actions SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA. -
Add to Cart The item has been addedSAB2107793-100ULANTI-SPRR2A
Price: $1,022.07List Price: $1,135.63Immunogen The immunogen for anti-SPRR2A antibody: synthetic peptide derected towards the N terminal of human SPRR2A Sequence Synthetic peptide located within the following region: CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK Physical -
Add to Cart The item has been addedHPA013149-100ULANTI-SPTBN1 (C005B-203771)
Price: $1,210.58List Price: $1,345.09The gene SPTBN1 (Spectrin β chain, non-erythrocytic 1) is localized to human chromosome 2. Spectrins belong to the superfamily of proteins called F-actin cross linking proteins that function as scaffolding proteins for protein sorting, cell
Pro-gastrin-releasing peptide tests
Browse our curated selection of Pro-gastrin-releasing peptide tests from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Pro-gastrin-releasing peptide tests
Cenmed Enterprises provides a comprehensive selection of Pro-gastrin-releasing peptide tests products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.