Pro-gastrin-releasing peptide tests

Immunogen Synthetic peptide directed towards the N terminal region of human SNRP70 Biochem/physiol Actions SNRP70 contains 1 RRM (RNA recognition motif) domain and mediates the splicing of pre-mRNA by binding to the loop I region of U1-snRNA.

Immunogen The immunogen for anti-SPRR2A antibody: synthetic peptide derected towards the N terminal of human SPRR2A Sequence Synthetic peptide located within the following region: CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK Physical

The gene SPTBN1 (Spectrin &#946 chain, non-erythrocytic 1) is localized to human chromosome 2. Spectrins belong to the superfamily of proteins called F-actin cross linking proteins that function as scaffolding proteins for protein sorting, cell

Immunogen Synthetic peptide directed towards the N terminal region of human TSPAN10 Biochem/physiol Actions TSPAN10 belongs to the tetraspanin (TM4SF) family. It is a multi-pass membrane protein.

General description Vasoactive intestinal peptide (VIP) receptors 1 and 2, termed VPAC1 and VPAC2, are members of the 7 transmembrane G protein-coupled receptor family. Both receptors bind to VIP and pituitary adenylate cyclase-activating

Immunogen The immunogen for anti-ZAP70 antibody: synthetic peptide derected towards the middle region of human ZAP70 Sequence Synthetic peptide located within the following region: TDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRENLLVADIELGCGNFGS Physical

Amino Acid Sequence Glp-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 General description Gastrin releasing peptide receptor (GRP-R) belongs to the G protein-coupled receptors (GPCR) family. The gene for the gastrin‐releasing peptide

Amino Acid Sequence Glp-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2 General description Gastrin releasing peptide receptor (GRP-R) belongs to the G protein-coupled receptors (GPCR) family. The gene for the gastrin‐releasing peptide

Species : Bovine Assay Principle : Target Name : Gastric inhibitory polypeptide Sensitivity : Detection Range :

This peptide is an epitope of carcinoembryonic antigen and is recognized by T cells in the immune system it may have potential in the development of vaccines or targeting therapies. This analog differs slightly from the original peptide, with a

This peptide is an epitope of carcinoembryonic antigen and is recognized by T cells in the immune system it may have potential in the development of vaccines or targeting therapies. This analog differs slightly from the original peptide, with a

This peptide is an epitope of carcinoembryonic antigen and is recognized by T cells in the immune system it may have potential in the development of vaccines or targeting therapies. This analog differs slightly from the original peptide, with a