-
10010567-1Antigen: Acetylated KLH Host: mouse Cross-reactivity: (+) acetylated lysine residues (&minus) non-acetylated lysine residues Applications: ELISA, ICC, and WB Isotype: IgG1 This antibody is useful for monitoring levels of acetylation on various
-
13726-400
Thomas Scientific
Acetyl Lysine Polyclonal Antibody HRP Conjugate-400 æL
Price: $882.73List Price: $980.81Antigen: acetylated KLH Host: rabbit Cross-reactivity: (+) multi-species Application(s): ELISA, IF, IP, and WB This HRP-conjugated antibody is useful for monitoring levels of acetylation on various proteins. -
10011454-1
Thomas Scientific
Adenosine Receptor A2A Monoclonal Antibody (Clone 7FG-G5-A2)
Price: $556.69List Price: $618.54Antigen: human full length A2AR the antibody recognizes amino acids 213-220 as determined by epitope mapping Host: mouse, clone 7FG-G5-A2 Cross Reactivity: (+) human A2AR Application(s): WB A2AR is a multi-pass membrane protein found primarily in -
10008492-1
Thomas Scientific
Adipose Triglyceride Lipase Blocking Peptide-1 ea
Price: $291.59List Price: $323.99Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) To be used in conjunction with Cayman&rsquos Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block protein-antibody complex formation during -
10006409-1
Thomas Scientific
Adipose Triglyceride Lipase Polyclonal Antibody
Price: $556.69List Price: $618.54Antigen: human adipose triglyceride lipase (ATGL) amino acids 382-400 Host: rabbit Cross Reactivity: (+) human, mouse, and rat ATGL Application(s): IHC (paraffin-embedded tissue) and WB ATGL is one of the key enzymes involved in the mobilization of -
10337-1Antigen: human AdPLA2 amino acids 147-162 Host: rabbit Cross Reactivity: (+) human and mouse AdPLA2 other species not tested Application(s): WB AdPLA2 is highly expressed in adipose tissue, is associated with adipocyte differentiation and
-
14117-200
Thomas Scientific
Adropin Monoclonal Antibody (Clone CC1133F5)-200 æg
Price: $643.27List Price: $714.74Antigen: human adropin amino acids 34-76 Host: mouse, clone CC1133F5 Isotype: IgG1 Cross Reactivity: (+) human adropin Application(s): ELISA and WB -
10381-1Immunogen: thioredoxin fusion protein containing amino acids 34-76 of human adropin Host: rabbit Species Reactivity: (+) human adropin Application(s): ELISA and WB Adropin, encoded by the energy homeostasis associated gene, is involved in glucose
-
360773-1Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.
-
160773-1Antigen: human AIF amino acids 151-180 Host: rabbit Cross Reactivity: (+) human, rat, and mouse AIF other species not tested Application(s): WB AIF is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.
-
13733-1
Thomas Scientific
Akt1 (Phospho-Ser473) Monoclonal Antibody (Clone 104A282)
Price: $713.75List Price: $793.06Antigen: human Akt1 containing phospho-serine473 Host: mouse, clone 104A282 Isotype: IgG2&kappa Cross Reactivity: (+) human and mouse Akt1 Application(s): IP and WB Akt/PKB is a serine/threonine kinase that mediates cell survival and is thought to -
20162007-2Silica-coated uniform superparamagnetic beads, MagneZoom, with an aldehyde surface group. It is widely used to covalently couple ligands containing primary and secondary amino groups.