Protein Expression

Antigen: Acetylated KLH Host: mouse Cross-reactivity: (+) acetylated lysine residues (&minus) non-acetylated lysine residues Applications: ELISA, ICC, and WB Isotype: IgG1 This antibody is useful for monitoring levels of acetylation on various

Antigen: acetylated KLH Host: rabbit Cross-reactivity: (+) multi-species Application(s): ELISA, IF, IP, and WB This HRP-conjugated antibody is useful for monitoring levels of acetylation on various proteins.

Antigen: human full length A2AR the antibody recognizes amino acids 213-220 as determined by epitope mapping Host: mouse, clone 7FG-G5-A2 Cross Reactivity: (+) human A2AR Application(s): WB A2AR is a multi-pass membrane protein found primarily in

Peptide Sequence: human ATGL protein amino acids 382-400 (KRKLGRHLPSRLPEQVELR) To be used in conjunction with Cayman&rsquos Adipose Triglyceride Lipase polyclonal antibody (Catalog No. 10006409) to block protein-antibody complex formation during

Antigen: human adipose triglyceride lipase (ATGL) amino acids 382-400 Host: rabbit Cross Reactivity: (+) human, mouse, and rat ATGL Application(s): IHC (paraffin-embedded tissue) and WB ATGL is one of the key enzymes involved in the mobilization of

Antigen: human AdPLA2 amino acids 147-162 Host: rabbit Cross Reactivity: (+) human and mouse AdPLA2 other species not tested Application(s): WB AdPLA2 is highly expressed in adipose tissue, is associated with adipocyte differentiation and

Antigen: human adropin amino acids 34-76 Host: mouse, clone CC1133F5 Isotype: IgG1 Cross Reactivity: (+) human adropin Application(s): ELISA and WB

Immunogen: thioredoxin fusion protein containing amino acids 34-76 of human adropin Host: rabbit Species Reactivity: (+) human adropin Application(s): ELISA and WB Adropin, encoded by the energy homeostasis associated gene, is involved in glucose

Peptide Sequence: human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) To be used in conjunction with Cayman&rsquos AIF polyclonal antibody (Catalog No. 160773) to block protein-antibody complex formation during analysis for AIF.

Antigen: human AIF amino acids 151-180 Host: rabbit Cross Reactivity: (+) human, rat, and mouse AIF other species not tested Application(s): WB AIF is a highly conserved mitochondrial protein with roles in redox-biochemistry and apoptosis.

Antigen: human Akt1 containing phospho-serine473 Host: mouse, clone 104A282 Isotype: IgG2&kappa Cross Reactivity: (+) human and mouse Akt1 Application(s): IP and WB Akt/PKB is a serine/threonine kinase that mediates cell survival and is thought to

Silica-coated uniform superparamagnetic beads, MagneZoom, with an aldehyde surface group. It is widely used to covalently couple ligands containing primary and secondary amino groups.