Antibodies

Immunogen: peptide from the an internal region of human protein Species-Reactivity: (+) human, mouse, ovine, and rat mPGES-1 Application(s): IHC and WB

Peptide Sequence: amino acids 221-235 (VYGGKEARTEEMKWR) To be used in conjunction with Cayman&rsquos mPGE synthase-2 polyclonal antibody (Catalog No. 160145) to block protein-antibody complex formation during analysis for microsomal PGE synthase-2.

Antigen: synthetic peptide from the human mPGES-2 sequence conjugated to KLH amino acids 221-235 Host: rabbit Cross-Reactivity: (+) human, mouse, rat, ovine, bovine, and Cos-7 (African green monkey) mPGES-2 suspected positive with macaque but not ye

To be used in conjunction with Cayman&rsquos PGIS (mouse) Polyclonal Antibody (Item No. 100023) to block protein-antibody complex formation during immunochemical analysis of PGIS.

Immunogen: Synthetic peptide from the C-terminal region of mouse protein PGIS Host: Rabbit Species Reactivity: (+) human, bovine, mouse, ovine, and rat PGIS Application(s): IHC and WB PGIS catalyzes the isomerization of PGH2 to PGI2 (prostacyclin),

Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) To be used in conjunction with Cayman&rsquos PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.

Antigen: cell surface PGIS from follicular dendritic cell line HK Host: mouse Cross Reactivity: (+) human, mouse, and rat PGIS Application(s): WB, FC, ICC, IHC, and IP

Antigen: bovine lung PGIS Host: mouse, clone isn-1 Cross Reactivity: (+) bovine, mouse, rat, ovine, guinea pig, and rabbit PGIS Isotype: IgG1 Application(s): IHC and IP WB not recommended PGIS catalyzes the conversion of PGH2 to PGI2 (prostacyclin).

Antigen: bovine PGIS amino acids 299-329 Host: rabbit Cross Reactivity: (+) bovine, ovine, and human PGIS (&minus) rat PGIS Application(s): IP and WB PGIS catalyzes the isomerization of PGH2 to PGI2, a potent vasodilator and inhibitor platelet aggr

Peptide Sequence: human PGT C-terminal amino acids 627-640 To be used in conjunction with Cayman&rsquos Prostaglandin Transporter (C-Term) Polyclonal Antibody (Item No. 11860) to block protein-antibody complex formation during immunochemical

Antigen: human PGT C-terminal amino acids 627-640 Host: rabbit Cross Reactivity: (+) human, mouse, rat, cow, and sheep PGT expected to react with canine and chicken PGT Application(s): ICC, IF, and WB Transport of extracellular prostaglandins into

Peptide Sequence: human PGT amino acids 6-20 (KLGVSQGSDTSTSRA) To be used in conjunction with Cayman&rsquos PGT polyclonal antibody (Item No. 160200) to block protein-antibody complex formation during immunochemical analysis of PGT.