CAYMAN CHEMICAL
Prostaglandin I Synthase Blocking Peptide-200 g
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) To be used in conjunction with Cayman&rsquos PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Peptide Sequence: bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT) To be used in conjunction with Cayman&rsquos PGIS polyclonal antibody (Catalog No. 160640) to block protein-antibody complex formation during analysis for PGIS.
Specifications
- UPC:
- 12352211
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- WeightUOM:
- LB
- MPN:
- 360640-200



