-
HPA060640-100UL
Sigma-Aldrich
Anti-TOPORS antibody produced in rabbit (C15-1463-593)
Price: $928.29List Price: $1,031.43Immunogen topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA065661-100UL
Sigma-Aldrich
Anti-TOPORS antibody produced in rabbit (C15-1464-930)
Price: $928.29List Price: $1,031.43Immunogen topoisomerase I binding, arginine/serine-rich, E3 ubiquitin protein ligase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA051195-100ULImmunogen torsin family 1, member A (torsin A) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA047151-100UL
Sigma-Aldrich
Anti-TOR1AIP1 antibody produced in rabbit (C15-1459-148)
Price: $928.29List Price: $1,031.43Immunogen torsin A interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050546-100UL
Sigma-Aldrich
Anti-TOR1AIP1 antibody produced in rabbit (C15-1460-339)
Price: $928.29List Price: $1,031.43Immunogen torsin A interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070991-100UL
Sigma-Aldrich
ANTI-TOR1AIP1 ANTIBODY PRODUCED IN RABBIT (C15-1465-941)
Price: $977.14List Price: $1,085.71Immunogen torsin 1A interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA013403-100UL
Sigma-Aldrich
Anti-TOR1B antibody produced in rabbit (C15-1447-976)
Price: $879.43List Price: $977.14Immunogen Torsin-1B Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA013697-100UL
Sigma-Aldrich
Anti-TOR1B antibody produced in rabbit (C15-1448-010)
Price: $879.43List Price: $977.14Immunogen Torsin-1B Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA071229-100ULImmunogen Recombinant protein corresponding to torsin family 2 member A Sequence AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)
-
AV33117-100UL
Sigma-Aldrich
Anti-TOR3A antibody produced in rabbit (C15-1340-797)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the middle region of human TOR3A Sequence Synthetic peptide located within the following region: FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP Physical form Purified antibody supplied in 1x PBS -
HPA028766-100UL
Sigma-Aldrich
Anti-TOR3A antibody produced in rabbit (C15-1451-997)
Price: $879.43List Price: $977.14Immunogen torsin family 3, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA044913-100ULImmunogen chromosome 9 open reading frame 167 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,