Rabbit epithelium allergenic extract

Immunogen torsin A interacting protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen torsin 1A interacting protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Torsin-1B Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Torsin-1B Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to torsin family 2 member A Sequence AIFIFISNTGGEQINQVALEAWRSRRDREEILLQELEPVIS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Synthetic peptide directed towards the middle region of human TOR3A Sequence Synthetic peptide located within the following region: FHFPHPKYVDLYKEQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGP Physical form Purified antibody supplied in 1x PBS

Immunogen torsin family 3, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen chromosome 9 open reading frame 167 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the N terminal region of human TOX Biochem/physiol Actions Some high-mobility group (HMG) box proteins (e.g.

The gene thymocyte selection-associated high mobility group box protein (TOX) is mapped to human chromosome 8q12.1.

Immunogen thymocyte selection-associated high mobility group box Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

TOX high mobility group box family member 4 (TOX4) belongs to the HMG-box protein family and is expressed in the nucleus. It possesses lysine-based NLS (nuclear localization signal) and DNA-binding HMG box motif.