Pro-gastrin-releasing peptide tests

Immunogen Synthetic peptide directed towards the N terminal region of human DCTN2 Sequence Synthetic peptide located within the following region: ADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHI Physical form Purified antibody supplied in

General description Anti-GPR109 antibody detects endogenous levels of total GPR109 protein. GPR109B (G-protein coupled receptor 109B) is also called as hydroxycarboxylic acid receptor 3 (HCA3) and HM74 (G-protein coupled receptor).

General description ZooMAb &#174: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb &#174: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and

General description ZooMAb &#174: antibodies represent an entirely new generation of recombinant monoclonal antibodies. Each ZooMAb &#174: antibody is manufactured using our proprietary recombinant expression system, purified to homogeneity, and

General description MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC).

Immunogen Synthetic peptide directed towards the N terminal region of human METTL7A Sequence Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human MPEG1 Sequence Synthetic peptide located within the following region: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP Physical form Purified antibody supplied in 1x

Specificity Recognizes the S1/S2 junction of human ventricular myosin heavy chain beta Immunogen Epitope: heavy chain beta Human ventricular myosin Application Detect Myosin using this Anti-Myosin Antibody, heavy chain &#946: validated for

Immunogen synthetic peptide corresponding to amino acids 382-399 of rat P2X 1 (with additional N-terminal cysteine and serine). The epitope is highly conserved in mouse and human.

Specificity Integrin B1 phosphorylated on Thr788/789 Immunogen C-terminal Peptide Application Research Category Cell Structure Research Sub Category Integrins This Anti-phospho-Integrin &#9461 (Thr788/789) Antibody is validated for use in WB for

Immunogen Synthetic peptide directed towards the N terminal region of human PNN Sequence Synthetic peptide located within the following region: MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGP Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the N terminal region of human PP2447 Sequence Synthetic peptide located within the following region: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK Physical form Purified antibody supplied in 1x PBS