BIOWORLD
Protein G (Recombinant) (prospec), 1 mg
Recombinant Protein G contains only two IgG binding domain, but lacks the albumin binding domain to ensure the maximum specific IgG binding capacity. Protein G binds to all IgG subclasses from human, mouse and rat species.
Recombinant Protein G contains only two IgG binding domain, but lacks the albumin binding domain to ensure the maximum specific IgG binding capacity. Protein G binds to all IgG subclasses from human, mouse and rat species. The recombinant protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The protein G contains amino acids 190-384 having a molecular mass of 21.6 kDa. The protein G migrates on SDS PAGE around 32kDa. Source: E. coli Formulation: lyophilized white powder Purity: >95% as determined by SDS PAGE and RP-HPLC Amino acid sequence: MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE. Specificity: Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a. Does not bind to human IgM, IgD and IgA. Reconstitution: Reconstitute with deionized water or PBS Application: G binds to the constant region of many species of Immunoglobulin G. It can be used to detect, quantify and purify IgG antibodies and antibody/antigen complexes. Recombinant protein G contains only IgG binding domains. The albumin-binding domain as well as cell wall and cell membrane binding domains have been removed to ensure the maximum specific IgG binding capacity. Storage: 2 years at -20°C. After reconstitution, aliquot and store at -20°C.
Specifications
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- Quantity:
- 1
- Unit of Measurement:
- EA
- WeightUOM:
- LB
- MPN:
- 22060678-1
- Controlled Substances and Cyanide:
- Yes



