Streptavidin (C008B-266421)

Source：E. coli Molecular weight：13.3kDa for monomer, 53kDa for tetramerAccession：P22629 Ala37- Ser163 with an N-terminal MetProtein amino acid sequence：AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASPurity：≥98% by SDS-PAGE or HPLCFormulation：Lyophilized in 20 mM potassium phosphate buffer pH 6.5.Biotin binding activity ＞17U/mg rSA protein(one unit binds 1µg D-biotin)Endotoxin level：Advantage：1)high biotin binding activity 2)no extra amino sequence (tag free) 3)high purityProduct Form: Lyophilized powder, 20 mM potassium phosphate buffer, pH 6.5.Product Application：Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.：Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.

Specifications & Purity: Source：E. coli Molecular weight：13.3kDa for monomer, 53kDa for tetramerAccession：P22629 Ala37- Ser163 with an N-terminal MetProtein amino acid sequence：AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAASPurity：≥98% by SDS-PAGE or HPLCFormulation：Lyophilized in 20 mM potassium phosphate buffer pH 6.5.Biotin binding activity ＞17U/mg rSA protein(one unit binds 1µg D-biotin)Endotoxin level：Advantage：1)high biotin binding activity 2)no extra amino sequence (tag free) 3)high purityProduct Form: Lyophilized powder, 20 mM potassium phosphate buffer, pH 6.5.Product Application：Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.：Streptavidin is a biotin-binding protein that was originally isolated from Streptomyces avidinii. Streptavidin is superior to avidin because it has almost no net charge at neutral pH and does not contain carbohydrate and exhibits lower level of non-specific binding. Recombinant streptavidin is a tetrameric protein with a molecular weight of approximately 53kDa, consisting of four subunits of approximately 13kDa. Each subunit contains a single biotin-binding site and has six tyrosine residues. The purified recombinant streptavidin can be applied in detection of biotinylated antibodies and other probes in a variety of standard assay methods, including Western Blotting, ELISA, immunohistochemistry and fluorescence imaging.

Grade: BioReagent

MDL Number: MFCD00082035

EC Number: 618-481-6

PubChem CID: 51062757

Isomeric SMILES: C1CC[N+](=C(C2=CC(=CC=C2)Cl)SCC(=O)O)CC1.[Br-]

Storage Temperature: Store at -20°C;Argon charged

Shipped in: Ice chest + Ice pads

UPC:

51121921

Weight:

1.09 Ounces

HazmatClass:

Yes

Quantity:

1

Unit of Measurement:

EA

WeightUOM:

LB

MPN:

S1522291-1g

Country of Origin:

China

CAS:

9013-20-1

Product Size:

1g

Harmonized Tariff Code:

2931.90.90