Radiolabeled Peptides

Immunogen Synthetic peptide directed towards the C terminal of human CTSD Biochem/physiol Actions Ctsd is an acid protease active in intracellular protein breakdown. Sequence Synthetic peptide located within the following region:

Anti-FICD FIC domain containing, 100ul UN 1687 6.1 PG2

Immunogen Synthetic peptide directed towards the N terminal region of human KBTBD10 Biochem/physiol Actions KBTBD10 (KLHL41) belongs to the Kelch-like (KLHL) group of proteins that regulate motor function and myofibrillar function. Mutations in

Immunogen Synthetic peptide directed towards the C terminal region of human KBTBD5 Sequence Synthetic peptide located within the following region: ELVPTELNDIWRYNEEEKKWEGVLREIAYAAGATFLPVRLNVLCLTKM Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the C terminal region of human MOSC1 Sequence Synthetic peptide located within the following region: WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the middle region of human NEDD9 Biochem/physiol Actions Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold

Immunogen Synthetic peptide directed towards the middle region of human NUCB2 Biochem/physiol Actions NUCB2 is an oncoprotein that is overexpressed in breast cancer. This protein binds calcium and is involved in energy homeostasis and eating

Immunogen Synthetic peptide directed towards the N terminal region of human RAGE Sequence Synthetic peptide located within the following region: MKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKSGSLALICEL Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human RFPL3 Sequence Synthetic peptide located within the following region: DADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGR Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the C terminal region of human TAL1 Sequence Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR Physical form Purified antibody supplied in 1x

Immunogen Synthetic peptide directed towards the middle region of human TRPC4 Biochem/physiol Actions TRPC4 is thought to form a receptor-activated non-selective calcium permeant cation channel. TRPC4 probably is operated by a

TTC19 contains a tetratricopeptide repeat (TPR) domain that is believed to be involved in protein-protein interactions. Mutations in TTC19 have recently been shown to cause mitochondrial complex III deficiency and neurological impairment in humans.