Ceritinib

35mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs - (20/PK)

60mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs - (20/PK)

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Immunogen Synthetic peptide directed towards the C terminal region of human CUL2 Sequence Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA Physical form Purified antibody supplied in 1x

A convenient, ready-to-use, intermediate-level disinfectant. Kills TB in 3 minutes and HBV, HCV, and

Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material.

Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material.

Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material.

Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material.

A selective inhibitor of TAF1 bromodomain 2 (Kd = 1.8 &microM IC₅₀ = 0.9 &microM) synergizes with (+)-JQ1 to inhibit the proliferation of THP-1 and H23 lung adenocarcinoma cells.

InformationCeritinib dihydrochloride Ceritinib (Zykadia, LDK378) dihydrochloride is a selective, orally bioavailable and ATP-competitive inhibitor of ALK with IC50 of 0.2 nM. Ceritinib dihydrochloride also inhibits InsR , IGF-1R and STK22D with IC50

Ceritinib-d 7 is a deuterium labeled Ceritinib. Ceritinib is a selective, orally bioavailable and ATP-competitive ALK tyrosine kinase inhibitor.Form:Solid.