-
Add to Cart The item has been added70620135mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs
Price: $181.77List Price: $201.9635mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs - (20/PK) -
Add to Cart The item has been added70520160mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs
Price: $207.34List Price: $230.3860mm Cell Culture Dish, with Gripping Ring, TC, Sterile, 20/pk, 500/cs - (20/PK) -
Add to Cart The item has been addedSAB1301548-400ULANTI-CEPT1 (N-TERM)
Price: $895.88List Price: $995.43Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedSAB2100507-100ULANTI-CUL2 (C005B-476465)
Price: $976.72List Price: $1,085.24Immunogen Synthetic peptide directed towards the C terminal region of human CUL2 Sequence Synthetic peptide located within the following region: HNALIQEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA Physical form Purified antibody supplied in 1x -
Add to Cart The item has been added22138-1KG-FCELITE 535 FILTER AID FLUX CALCINED
Price: $181.53List Price: $201.69Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material. -
Add to Cart The item has been added22141-100G-FCELITE 545 AW FILTER AID ACID WASHED TREATED WITH SODIUM CARBONATE FLUX CALCINED (C005B-057315)
Price: $808.78List Price: $898.65Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material. -
Add to Cart The item has been added22140-1KG-FCELITE 545 FILTER AID TREATED WITH SODIUM CARBONATE FLUX CALCINED (C005B-057313)
Price: $148.50List Price: $165.00Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material. -
Add to Cart The item has been added22140-5KG-FCELITE 545 FILTER AID TREATED WITH SODIUM CARBONATE FLUX CALCINED (C005B-057314)
Price: $374.83List Price: $416.48Diatomaceous earth is made up of natural amorphous silica formed from the fossilized skeletons of diatoms. It is extracted, crushed, dried and calcined with flux material. -
Add to Cart The item has been added19956-10CeMMEC1-10 mg
Price: $1,054.81List Price: $1,172.02A selective inhibitor of TAF1 bromodomain 2 (Kd = 1.8 µM IC<sub>50</sub> = 0.9 µM) synergizes with (+)-JQ1 to inhibit the proliferation of THP-1 and H23 lung adenocarcinoma cells. -
Add to Cart The item has been addedC421439-1mlCeritinib dihydrochloride (C007B-102667)
Price: $251.54List Price: $279.49InformationCeritinib dihydrochloride Ceritinib (Zykadia, LDK378) dihydrochloride is a selective, orally bioavailable and ATP-competitive inhibitor of ALK with IC50 of 0.2 nM. Ceritinib dihydrochloride also inhibits InsR , IGF-1R and STK22D with IC50 -
Add to Cart The item has been addedC650929-1mgCeritinib-d7
Price: $1,338.93List Price: $1,487.70Ceritinib-d 7 is a deuterium labeled Ceritinib. Ceritinib is a selective, orally bioavailable and ATP-competitive ALK tyrosine kinase inhibitor.Form:Solid. -
Add to Cart The item has been addedPSC050CERTOL PROSPRAY SURFACE CLEANER/DISINFECTANT (C001B-055255)
Price: $208.09List Price: $231.21A ready-to-use dual synthetic phenolic disinfectant/cleaner for environmental surfaces in healthcare settings. Broad spectrum intermediate level activity against TB, HIV meets CDC guidelines.
Ceritinib
Browse our curated selection of Ceritinib from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Ceritinib
Cenmed Enterprises provides a comprehensive selection of Ceritinib products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.