Immunology

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Specificity 14-3-3 Protein, phosphoSerine58. The antibody recognizes a protein of ~29 kDa corresponding to 14-3-3 Protein, phosphoSerine58 in lysates from rat brainstem.

Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers, thus rendering 14-3-3 as a key multifunctional regulatory molecule. 14-3-3 isomers have been implicated in

Immunogen Recombinant protein corresponding to septin 8. Sequence NAFNRRKAAVEALQSQALHATSQQPLRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Tumor protein p53 binding protein (T153BP1) is mapped to human chromosome 15q15.3.

Anti-á-Amyloid42 (FCA3542) Rabbit Antibody, 50UL

Immunogen alpha-2-macroglobulin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen alpha-2-macroglobulin-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen &#945-1,4-N-Acetylglucosaminyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen acetoacetyl-CoA synthetase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human AADAC Application Anti-AADAC antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml.