-
HPA075184-100ULImmunogen Recombinant protein corresponding to CASK interacting protein 2 Sequence GHIHESQRGTDRIGYFPPGIVEVVSKRVGIPAARLPSAPTPLRPGFSRTPQPPAEEPPHPLTYSQLPRVGLSPDSPAGDRNSV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and
-
HPA017059-100ULCASP10 (caspase 10) is a cysteine protease consisting of two death effector domains (DEDs). It is expressed in the Gimen cells, B and T lymphoma cell lines.
-
HPA027062-100ULImmunogen caspase 14, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA050678-100ULImmunogen caspase 2, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
AV00021-100UL
Sigma-Aldrich
Anti-CASP3 antibody produced in rabbit (C15-1340-519)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human CASP3 Biochem/physiol Actions CASP3 is a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a -
HPA002643-100UL
Sigma-Aldrich
Anti-CASP3 antibody produced in rabbit (C15-1445-625)
Price: $879.43List Price: $977.14CASP3 (caspase 3), the allosteric regulator, is a member of the cysteine-aspartic acid protease (caspase) family which is involved in the inflammation and mammalian apoptosis. It consists of binding sites for small molecules and peptides. -
HPA027588-100ULImmunogen caspase 4, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
HPA040937-100ULImmunogen caspase 5, apoptosis-related cysteine peptidase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
HPA011337-100UL
Sigma-Aldrich
Anti-CASP6 antibody produced in rabbit (C15-1447-587)
Price: $879.43List Price: $977.14CASP6 (caspase 6) belongs to the family of cysteine proteases called caspases. Caspases can be divided into inflammatory capases, apoptosis initiators and effector caspases, and CASP6 belongs to the effector class. -
HPA024303-100UL
Sigma-Aldrich
Anti-CASP6 antibody produced in rabbit (C15-1450-716)
Price: $879.43List Price: $977.14Immunogen Caspase-6 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
AB1871Caspase-1 (ICE, interleukin-1b-converting enzyme) is the mammalian caspase responsible for the proteolytic conversion of the proforms of interleukin-1b and IL-18 into active cytokines. Like other caspases, caspase-1 itself is synthesized as a
-
AB3613Three distinct signaling pathways lead to apoptosis. The death receptor and mitochondrion pathways are the two mains, which involve respectively caspase-8 and caspase-9.