Immunology

CCT5 (chaperonin containing TCP1 subunit 5) is a cytosolic chaperonin containing protein involved in the organization of the cytoskeleton. It is localized in the microtubular structures and nucleus.

Immunogen T-complex protein 1 subunit epsilon recombinant protein epitope signature tag (PrEST) Sequence

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chaperonin containing TCP1, subunit 6A (zeta 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Chaperonin containing TCP1 subunit 7 (&#951) (CCT7) is a 181-amino-acid protein (21kDa) localized in the cytoplasm and nucleus. It is composed of two rings, one on top of the other, forming a cylinder.

Immunogen CD109 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to CD109 molecule Sequence GPVEILTTVTESVTGISRNVSTNVFFKQHDYIIEFFDYTTVLKPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQRNYTEYWSGSNSGNQKMEAVQKINYTVPQSGTFKIEFPILEDSSELQLKAYFLGSKSSMA Application All Prestige Antibodies

This 145 kDa molecule is a member of the tyrosine kinase receptor family and is expressed by a majority of hematopoietic progenitor cells. The interaction of the mouse c-kit receptor and steel factor promotes proliferation and differentiation of

Specificity This antibody recognizes both the soluble and membrane bound human IL-6 receptor. The antibody will inhibit IL-6 mediated proliferation of XG-1 cells and partially blocks the binding of IL-6 to its receptor.

Immunogen Immunogen Sequence: GI # 4557417 , sequence 40-230 Recombinant CD14 antigen Application Anti-CD14 antibody produced in chicken is suitable for western blotting analysis at a dilution of 1:500, for tissue or cell staining at a dilution of

CD14 is a phospholipid anchored membrane protein with 55kDa molecular mass. It contains a bent solenoid, high leucine content (15.