Immunology

Specificity The CD19 antigen (90 kDa) is expressed from the earliest stages of B-progenitor development, on all peripheral B cells including germinal centre B cells and all B cell lines and B cell leukaemias tested. T cell and monocytic cell lines

CD1A (cluster of differentiation 1A) belongs to a family of antigen-presenting proteins called CD1. These are evolutionary conserved proteins which present lipids instead of peptide.

CD1B (CD1b molecule) is a lipid antigen presenting glycoprotein belonging to the group of major histocompatibility complex class I-like glycoproteins. It consists of an antigen-binding groove connected with four interlinked hydrophobic channels.

Immunogen CD1d molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen CD1e molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen T-cell surface antigen CD2 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Langerin (CD207) is a C-type lectin, which is expressed on Langerhans cells. It contains a C-type carbohydrate recognition domain (CRD) in its extracellular region.

Immunogen CD22 molecule recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen CD226 antigen precursor recombinant protein epitope signature tag (PrEST) Application Anti-CD226 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is

Immunogen CD226 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to CD226 molecule Sequence EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen Recombinant protein corresponding to CD24 molecule Sequence TTGTSSNSSQSTSNSGLAPNPTNATTKVAGGALQSTASLFVVSLSLLHLYS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)