Immunology

CD9 is a glioma stem cell (GSC)-enriched protein, which belongs to tetraspanin family. It is a cell motility related molecule.

Specificity This antibody reacts with a 25 kDa molecular weight band on gels of non-reduced platelet membranes and immunoprecipitates a similar band from Iodine125-labeled platelets. The antigen is expressed on eosinophils, granulocytes, monocytes

CD93 (cluster of differentiation 93) is a cell surface receptor for heat-sensitive complement factor C1q, and hence, is also called C1qR. This protein shows major expression on endothelial cells.

Immunogen Complement component C1q receptor precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CD96 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen CD99 molecule recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Uncharacterized protein C21orf136 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen CD99 molecule-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen CD99 molecule-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen Recombinant protein corresponding to CD99 molecule like 2 Sequence QQKKFCFSIQQGLNADYVKGENLEAVVCEEPQVKYSTLHTQSAEPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen cytidine and dCMP deaminase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cytidine and dCMP deaminase domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive