-
HPA039404-100UL
Sigma-Aldrich
Anti-CDAN1 antibody produced in rabbit (C15-1455-715)
Price: $928.29List Price: $1,031.43Immunogen congenital dyserythropoietic anemia, type I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA040787-100UL
Sigma-Aldrich
Anti-CDAN1 antibody produced in rabbit (C15-1456-360)
Price: $928.29List Price: $1,031.43Immunogen codanin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA037830-100UL
Sigma-Aldrich
Anti-CDC123 antibody produced in rabbit (C15-1454-933)
Price: $928.29List Price: $1,031.43Immunogen cell division cycle 123 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
HPA057540-100UL
Sigma-Aldrich
Anti-CDC123 antibody produced in rabbit (C15-1462-684)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cell division cycle 123 Sequence DSLLFTWEELISENNLNGDFSEVDAQEQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA023783-100ULImmunogen Dual specificity protein phosphatase CDC14A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a
-
HPA013312-100UL
Sigma-Aldrich
Anti-CDC14B antibody produced in rabbit (C15-1447-944)
Price: $879.43List Price: $977.14Immunogen Dual specificity protein phosphatase CDC14B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA064747-100UL
Sigma-Aldrich
Anti-CDC14B antibody produced in rabbit (C15-1464-719)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to cell division cycle 14B Sequence RCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA042826-100ULImmunogen cell division cycle 16 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
AB3241-25UL
Sigma-Aldrich
Anti-Cdc2 Antibody, phospho-specific (Tyr15) (C15-1316-039)
Price: $319.59List Price: $355.10Specificity CDC2, phosphoTyr15. By Western blot the antibody recognizes the ~35 kDa phospho CDC2 protein. -
HPA053900-100ULImmunogen cell division cycle 20 homolog B (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
HPA039593-100ULImmunogen cell division cycle 23 homolog ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as
-
HPA008803-100ULImmunogen cell division cycle 25A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the