Immunology

Immunogen Recombinant protein corresponding to cell division cycle 42 Sequence NVFDEAILAALEPPETQPKRKCCIF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 binding protein kinase alpha (DMPK-like) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CDC42BPB (CDC42 binding protein kinase beta, DMPK-like) is a 190kDa multi-domain protein belonging to the subfamily of Rho GTPase activated serine/threonine kinases within the AGC-family. AGC family members mainly support the actomyosin

Immunogen Serine/threonine-protein kinase MRCK gamma recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 binding protein kinase gamma (DMPK-like) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CDC42EP1 (CDC42 effector protein 1) is a non-kinase effector protein that interacts with GTP-bound CDC42. It contains multiple proline-rich repeats and a CRIB (Cdc42/Rac interactive-binding) domain.

Immunogen CDC42 effector protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen CDC42 effector protein (Rho GTPase binding) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 effector protein (Rho GTPase binding) 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to CDC42 effector protein 3 Sequence DISFLQGNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

CDC42EP4 (CDC42 effector protein 4) belongs to the BORG (binder of Rho GTPases) family of proteins. It is widely expressed and the gene is mapped to human chromosome 17q24-25.

Immunogen CDC42 effector protein (Rho GTPase binding) 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a