Immunology

Immunogen Recombinant protein corresponding to centrosomal protein 164 Sequence EVRSTEPVAPPEQLSEAALKAMEEAVAQVLEQDQRHLLESKQEKMQQLREKLCQEEEEEILRLHQQKEQSLSSLRERLQKAIEEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to centrosomal protein 170 Sequence KQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen centrosomal protein 170kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen centrosomal protein 192kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Centrosomal protein 192 (CEP192) is a 192 kDa protein present in the centrosome. Cep192 is located on human chromosome 18p11.

Immunogen centrosomal protein 250kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Human monocyte serine esterase 1 (HMSE1) is an esterase isoenzyme expressed in monocyte/macrophages that can be inhibited by NaF in &#945-naphthyl acetate cytochemical staining applications. Intensive analysis of normal and malignant hematopoietic

Immunogen Synthetic peptide directed towards the C terminal region of human CES1 Biochem/physiol Actions CES1 is one of the enzymes responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also

The gene CES2 (carboxylesterase 2) is mapped to human chromosome 16q22.1.

Immunogen cilia and flagella associated protein 126 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

C9orf117 (chromosome 9 open reading frame 117) is shown to be present in the cilia of bronchus and fallopian tube. Immunogen cilia and flagella associated protein 157 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and