Immunology

CHEK1 is a serine/threonine kinase that functions as a sensor for the stress response pathway in cells. It is activated by ATR kinase phosphorylation in response to DNA damage, and can subsequently modulate p53 phosphorylation.

Immunogen checkpoint kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Serine/threonine-protein kinase Chk2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Specificity Recognizes Chemokine-Like Receptor 1 [CMKLR1]. Immunogen Synthetic peptide from the N-terminal extracellular domain of human Chemokine-Like Receptor 1.

Specificity Recognizes Chemokine-Like Receptor 1 [CMKLR1]. Immunogen Synthetic peptide from the N-terminal extracellular domain of human Chemokine-Like Receptor 1.

Immunogen Synthetic peptide directed towards the N terminal region of human CHGA Biochem/physiol Actions CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons

Chromogranin A (CHGA) or CgA is a neuro-secretory protein, and is a member of the granin family. This protein is usually found within chromaffin granules in the adrenal medulla and released along with the catecholamines.

Immunogen Chromogranin b Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Secretogranin-1 precursor recombinant protein epitope signature tag (PrEST) Sequence KQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDS Application All Prestige

Chromogranin B (CHGB) is a water-soluble acidic glycoprotein that is present in almost all endocrine, neuroendocrine and neuronal tissue. It functions as a specific neuroendocrine (NE) marker in cells and tumors.

Immunogen Chitinase 3 like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Chitinase 3 like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.