Immunology

Immunogen chitinase 3 like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Chitinase 3-like 2 (CHI3L2) is very similar to CHI3L1, which in turn belongs to Chitinase-like protein (CLP) family. They have the same residues at their amino acid terminal.

Immunogen cysteine-rich hydrophobic domain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Cysteine-rich hydrophobic domain-containing protein 2 (CHIC2), also referred to as BTL (brx-like translocated in leukemia), belongs to cysteine-rich hydrophobic (CHIC) family of proteins. The protein is characterized with the striking CHIC motif.

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Chicken IgY is made of two heavy (H) and two light (L) chains. Its molecular weight is about ~180 kDa.

Birds, reptiles and amphibians express IgY antibodies that are functionally equivalent to IgG. Anti-Chicken IgY (IgG) (whole molecule)-FITC antibody is specific for IgY of chicken.

Birds, reptiles and amphibians express IgY antibodies that are functionally equivalent to IgG. Anti-Chicken IgY (IgG) (whole molecule)-FITC antibody is specific for IgY of chicken.

CHIP (carboxy terminus of Hsp70-interacting protein, also known as STIP1-homology and U-box containing protein 1, STUB1, HSPABP2, NY-CO-7, SDCCAG7, UBOX1), is a dual-function chaperone/E3 ubiquitin ligase. CHIP has 3 functional domains: a

U box domain E3 ubiquitin ligase. CHIP E3 controls both the association of Hsp70/Hsp90 chaperones with ErbB2 and the down-regulation of ErbB2 induced by inhibitors of Hsp90.

The protein encoded by this gene is a serine/threonine-protein kinase that acts as a cell cycle checkpoint regulator and a putative tumor suppressor. It contains a C-terminal kinase domain, an N-terminal regulatory region that is rich in TQ and SQ