Immunology

The gene CHKB (Choline/ethanolamine kinase &#946) is mapped to human chromosome 22q13.33.

CHL1 (cell adhesion molecule L1-like) is also called as CALL (cell adhesion L1-like) and is expressed in normal tissues, brain, and a variety of human cancer cell lines and primary tumor tissues. The gene is mapped to human chromosome 3p26.

Immunogen peptide corresponding to amino acid residues 401-415 of rat CLC5. Mouse sequence is identical human sequence is 14/15 residues identical.

Immunogen peptide corresponding to amino acid residues 401-415 of rat CLC5. Mouse sequence is identical human sequence is 14/15 residues identical.

Immunogen charged multivesicular body protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen charged multivesicular body protein 1B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chromatin modifying protein 4B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen charged multivesicular body protein 4B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Charged multivesicular body protein 4c recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen charged multivesicular body protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen charged multivesicular body protein 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the N terminal region of human CHN2 Sequence Synthetic peptide located within the following region: AFGVKVGVKGGFLWPPLKLFACSQISSLVRRAALTHNDNHFNYEKTHNFK Physical form Purified antibody supplied in 1x PBS