Immunology

Immunogen ATP-binding cassette, sub-family C (CFTR/MRP), member 12 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen ATP binding cassette subfamily C member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family D (ALD), member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen ATP-binding cassette, sub-family D (ALD), member 3 recombinant protein epitope signature tag (PrEST) Features and Benefits Prestige Antibodies &#174 are highly characterized and extensively validated antibodies with the added benefit of

Immunogen Recombinant protein corresponding to ABL proto-oncogene 2, non-receptor tyrosine kinase Sequence SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF Application All Prestige Antibodies Powered

Immunogen actin binding LIM protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen actin binding LIM protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to activator of basal transcription 1 Sequence SKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen ankyrin repeat and BTB (POZ) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Ankyrin repeat and BTB/POZ domain-containing protein 2 (ABTB2) is an adaptor protein for cullin 3 which is an E3-ubiquitin ligase scaffold protein. Immunogen Ankyrin repeat and BTB/POZ domain-containing protein 2 recombinant protein epitope

Immunogen ankyrin repeat and BTB (POZ) domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive