Immunology

Immunogen contactin associated protein-like 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen contactin associated protein-like 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

The gene CNTROB (centrobin) is mapped to human chromosome 17p13. The protein localizes in the centrioles and is also present in the cytoplasm.

The gene CNTROB (centrobin) is mapped to human chromosome 17p13. The protein localizes in the centrioles and is also present in the cytoplasm.

The gene CNTROB (centrobin) is mapped to human chromosome 17p13. The protein localizes in the centrioles and is also present in the cytoplasm.

The gene CNTROB (centrobin) is mapped to human chromosome 17p13. The protein localizes in the centrioles and is also present in the cytoplasm.

Cofilin-1 (UniProt P23528 also known as 18 kDa phosphoprotein, Cofilin non-muscle isoform, p18) is encoded by the CFL1 (also known as CFL) gene (Gene ID 1072) in human. Cofilin-1 (non-muscle cofilin), cofilin-2 (muscle cofilin), and

Immunogen component of oligomeric golgi complex 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen component of oligomeric golgi complex 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to component of oligomeric golgi complex 3 Sequence DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT Application All Prestige Antibodies Powered by Atlas

The cohesin subunit SA-2 is a part of the cohesin complex. This complex is comprised of a heterodimer between SMC1 and SMC3 proteins, as well as RAD21 and STAG proteins (STAG1, 2, or 3).

Immunogen collagen, type XI, alpha 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the