Immunology

Immunogen coatomer protein complex, subunit beta 2 (beta prime) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen coatomer protein complex, subunit epsilon Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen coatomer protein complex, subunit epsilon Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Cortactin gene is located on human chromosome 11q13. Cortactin exists as multiple isoforms (75-85 kDa), formed by alternative splicing.

Cortactin is an F-actin binding protein. It belongs to a highly conserved family of perimembrane signaling protein.

Immunogen Ceruloplasmin precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Carboxypeptidase A1 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen carboxypeptidase A1 (pancreatic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Carboxypeptidase A2 (CPA2) is formed by the release of the 81-residue activation domain of its proenzyme-procarboxypeptidase A2. Immunogen Carboxypeptidase A2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige

The gene CPA2 (carboxypeptidase A2) is mapped to human chromosome 7q32. The protein is secreted by the pancreas in the form of an inactive proenzyme.

CPA3 (carboxypeptidase A3) forms a major component of mast cell secretory granules. It is a zinc-dependent metalloprotease.

Immunogen Mast cell carboxypeptidase A precursor recombinant protein epitope signature tag (PrEST) Sequence KNQNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVYITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSL Application